PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7903s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 274aa    MW: 31229.6 Da    PI: 7.2824
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7903s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-2159117356
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                          +R+++t+eq+++Leel+++ +r+p++e+++++A+kl    +++ ++V++WFqN++a+e+
  Bostr.7903s0027.1.p  59 SRWNPTPEQITTLEELYRSgTRTPTTEQIQKIASKLrkygRIEGKNVFYWFQNHKARER 117
                          7*****************99*************************************98 PP

2Wus_type_Homeobox114.55.2e-3757119264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          a++RW+PtpeQi+ Leely+sG+rtP++e+iq+i+++L++yG+ie+kNVfyWFQN+kaRer k
  Bostr.7903s0027.1.p  57 ATSRWNPTPEQITTLEELYRSGTRTPTTEQIQKIASKLRKYGRIEGKNVFYWFQNHKARERLK 119
                          689**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.43454119IPR001356Homeobox domain
SMARTSM003897.4E-656123IPR001356Homeobox domain
SuperFamilySSF466893.59E-1258118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-859117IPR009057Homeodomain-like
PfamPF000462.8E-1959117IPR001356Homeobox domain
CDDcd000864.16E-560114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGYVSDNNLI NYLPLYTTQP HLLLTHCDIN GNDHHQLIPA SSGELDGGKS NIPAAAATSR  60
WNPTPEQITT LEELYRSGTR TPTTEQIQKI ASKLRKYGRI EGKNVFYWFQ NHKARERLKR  120
RRREGGTINN VREPHQGVKD SSSGGYRIDR TKSFLSFPHT DAQPQHELVP ASYNKDNNED  180
HGTTEESERA SEGGKDITWR NLVTSSITQE PGEITIDENV NGEVETREIR TLNLFPVLEN  240
QEKTSRFKEK KNTNANQVCC NYCFYYEFLP LKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0858320.0AY085832.1 Arabidopsis thaliana clone 18820 mRNA, complete sequence.
GenBankAY2513990.0AY251399.2 Arabidopsis thaliana WOX6 protein mRNA, complete cds.
GenBankAY8852220.0AY885222.1 Arabidopsis thaliana pretty few seeds 2 (PFS2) mRNA, complete cds.
GenBankDQ4464510.0DQ446451.1 Arabidopsis thaliana clone pENTR221-At2g01500 homeobox-leucine zipper transcription factor family protein (At2g01500) mRNA, complete cds.
GenBankDQ6529450.0DQ652945.1 Arabidopsis thaliana clone 0000012888_0000009296 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010513873.11e-159PREDICTED: WUSCHEL-related homeobox 6-like
SwissprotQ9ZVF51e-135WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLD7LLR91e-146D7LLR9_ARALL; H
STRINGfgenesh2_kg.5__60__AT2G01500.11e-146(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.11e-136WOX family protein